- Explore MCP Servers
- crewai_mcp_adapter
Crewai Mcp Adapter
What is Crewai Mcp Adapter
crewai_mcp_adapter is a Python library that extends CrewAI’s adapter ecosystem by integrating support for the Model Context Protocol (MCP) and providing comprehensive tools for developing custom agents and tools.
Use cases
Use cases include building calculators, automating tasks, and creating custom agents that interact with various tools and services through the MCP protocol.
How to use
To use crewai_mcp_adapter, install it via PyPI or from source. Then, create an instance of CrewAIAdapterClient to connect to the MCP server, define an agent with tools, and execute tasks using the provided interface.
Key features
Key features include native CrewAI integration, MCP protocol support for tool integration, an easy-to-use interface for creating new adapters, type-safe implementation with Pydantic, JSON Schema validation for tool parameters, async/await support, and detailed execution metadata.
Where to use
crewai_mcp_adapter can be used in various fields such as data analysis, automation, and any domain requiring custom agent development and tool integration.
Clients Supporting MCP
The following are the main client software that supports the Model Context Protocol. Click the link to visit the official website for more information.
Overview
What is Crewai Mcp Adapter
crewai_mcp_adapter is a Python library that extends CrewAI’s adapter ecosystem by integrating support for the Model Context Protocol (MCP) and providing comprehensive tools for developing custom agents and tools.
Use cases
Use cases include building calculators, automating tasks, and creating custom agents that interact with various tools and services through the MCP protocol.
How to use
To use crewai_mcp_adapter, install it via PyPI or from source. Then, create an instance of CrewAIAdapterClient to connect to the MCP server, define an agent with tools, and execute tasks using the provided interface.
Key features
Key features include native CrewAI integration, MCP protocol support for tool integration, an easy-to-use interface for creating new adapters, type-safe implementation with Pydantic, JSON Schema validation for tool parameters, async/await support, and detailed execution metadata.
Where to use
crewai_mcp_adapter can be used in various fields such as data analysis, automation, and any domain requiring custom agent development and tool integration.
Clients Supporting MCP
The following are the main client software that supports the Model Context Protocol. Click the link to visit the official website for more information.
Content
CrewAI MCP Adapter
A Python library extending CrewAI’s adapter ecosystem with Model Context Protocol (MCP) integration support and comprehensive tooling for custom agent and tool development.
Features
- 🔌 Native CrewAI integration and adapter patterns
- 🛠️ MCP protocol support for tool integration
- 🧩 Easy-to-use interface for extending and creating new adapters
- 📝 Type-safe implementation with Pydantic
- 🔍 JSON Schema validation for tool parameters
- 🚀 Async/await support
- 📊 Detailed execution metadata
Installation
You can install the package directly from PyPI:
pip install crewai-adapters
Or install from source:
pip install git+https://github.com/dshivendra/crewai_mcp_adapter.git
Quick Start
from crewai import Agent, Task
from crewai_adapters import CrewAIAdapterClient
from crewai_adapters.types import AdapterConfig
async def main():
async with CrewAIAdapterClient() as client:
# Connect to MCP server
await client.connect_to_mcp_server(
"math",
command="python",
args=["math_server.py"]
)
# Create agent with tools
agent = Agent(
name="Calculator",
goal="Perform calculations",
tools=client.get_tools()
)
# Execute task
task = Task(
description="Calculate (3 + 5) × 12",
agent=agent
)
result = await task.execute()
print(f"Result: {result}")
if __name__ == "__main__":
import asyncio
asyncio.run(main())
Documentation
For detailed documentation, see:
Development
Prerequisites
- Python 3.11 or higher
crewaipackagepydanticpackagemcppackage
Install Development Dependencies
pip install -e ".[test,docs]"
Running Tests
pytest tests/ -v
Publishing
To publish a new version to PyPI:
- Update version in pyproject.toml
- Build the package:
python -m build - Upload to PyPI:
python -m twine upload dist/*
License
This project is licensed under the MIT License - see the LICENSE file for details.
Contributing
Contributions are welcome! Please feel free to submit a Pull Request.
Dev Tools Supporting MCP
The following are the main code editors that support the Model Context Protocol. Click the link to visit the official website for more information.











